RetrogeneDB ID: | retro_dnov_1149 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_1549:52902..53235(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SPAG7 | ||
| Ensembl ID: | ENSDNOG00000011669 | ||
| Aliases: | None | ||
| Description: | sperm associated antigen 7 [Source:HGNC Symbol;Acc:11216] |
| Percent Identity: | 61.02 % |
| Parental protein coverage: | 57.07 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 5 |
| Parental | VEFRKRMEKE-VSDFIQDSGQTK-KKFQP-MSKIERSILHDVVE-VAGLTSFSFGEDDECRYVMIFKKEF |
| V.F.KRMEKE.VSDFIQDSGQ.K...FQ..MSKIER.ILH..VE.V.GL.SFSF.EDD.C.Y.MIFKKEF | |
| Retrocopy | VVFHKRMEKE<VSDFIQDSGQVK<EMFQQ<MSKIERHILHHMVE<VVGLASFSFWEDDKCHYIMIFKKEF |
| Parental | APSDEELESY-RRGEEWDPQKAAEKRKLKELAQRQEEEAAQQGPTVVS |
| A.SDE.L.SY...GEEW.......K....EL......EAAQ.G...VS | |
| Retrocopy | ALSDEDLDSY>HHGEEWN-SDG*GKTEAEELGPVAGREAAQWGRAAVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 41 .42 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 73 .27 RPM |
| SRP012922_heart | 0 .00 RPM | 74 .95 RPM |
| SRP012922_kidney | 0 .00 RPM | 87 .07 RPM |
| SRP012922_liver | 0 .00 RPM | 25 .85 RPM |
| SRP012922_lung | 0 .00 RPM | 109 .05 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 92 .43 RPM |
| SRP012922_spleen | 0 .00 RPM | 77 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006299 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015761 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011669 | 1 retrocopy |
retro_dnov_1149 ,
|
| Echinops telfairi | ENSETEG00000020098 | 1 retrocopy | |
| Felis catus | ENSFCAG00000030469 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007933 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014031 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018287 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001108 | 1 retrocopy |