RetrogeneDB ID: | retro_cpor_853 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:24302462..24302813(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | H3F3B | ||
| Ensembl ID: | ENSCPOG00000004707 | ||
| Aliases: | None | ||
| Description: | Histone H3 [Source:UniProtKB/TrEMBL;Acc:H0V3S0] |
| Percent Identity: | 73.11 % |
| Parental protein coverage: | 87.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR |
| .AR.K..A.KST.GKAP.K.LATKAA.KSAPSTG.V.KPHRYR.GTVAL.EIR.YQKS.E....KL.FQR | |
| Retrocopy | LARIKRNACKSTSGKAPKK*LATKAAFKSAPSTGRVEKPHRYRAGTVALCEIRCYQKSSEW--HKLTFQR |
| Parental | LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT |
| L....AQDFK..LRFQSAAI.ALQEASE..LVGLFEDTNLCAI.AK.V. | |
| Retrocopy | LALDFAQDFKPNLRFQSAAISALQEASEVSLVGLFEDTNLCAIRAKCVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 67 .75 RPM |
| SRP017611_kidney | 0 .10 RPM | 163 .52 RPM |
| SRP017611_liver | 0 .30 RPM | 79 .74 RPM |
| SRP040447_lung | 0 .05 RPM | 205 .10 RPM |
| SRP040447_skeletal_muscle | 0 .08 RPM | 127 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009765 | 3 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000009661 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000004707 | 7 retrocopies |
retro_cpor_1059, retro_cpor_1390, retro_cpor_1524, retro_cpor_432, retro_cpor_695, retro_cpor_842, retro_cpor_853 ,
|
| Loxodonta africana | ENSLAFG00000021624 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015447 | 10 retrocopies | |
| Mus musculus | ENSMUSG00000060743 | 19 retrocopies |
retro_mmus_1053, retro_mmus_1116, retro_mmus_1139, retro_mmus_1151, retro_mmus_1254, retro_mmus_2285, retro_mmus_2614, retro_mmus_2934, retro_mmus_3009, retro_mmus_3213, retro_mmus_3425, retro_mmus_395, retro_mmus_498, retro_mmus_808, retro_mmus_884, retro_mmus_885, retro_mmus_886, retro_mmus_959, retro_mmus_960,
|
| Oryctolagus cuniculus | ENSOCUG00000024644 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000024226 | 8 retrocopies | |
| Tupaia belangeri | ENSTBEG00000006177 | 13 retrocopies |