RetrogeneDB ID: | retro_cpor_826 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:17179934..17180278(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SSR3 | ||
| Ensembl ID: | ENSCPOG00000005898 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 64.86 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 1 |
| Parental | MAPKGGSKQQSEEDLLLQDFSRNLSAKS-SALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVS |
| MA.KGGSK..S.E.LLLQ.FS..L.AKS.SALFF.N.F..SA.PI.LYW..W.MDLI......SVM...S | |
| Retrocopy | MAAKGGSKLHSSEALLLQNFSCSLKAKS<SALFFRNPFTMSATPI*LYW*MW*MDLIH---MDSVMMAIS |
| Parental | TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRRMSRKEKDER |
| .YLV.FA..NVKFVLKHK.AQKREDA....V..KLS.A.NR.MS..EKDER | |
| Retrocopy | LYLVIFANQNVKFVLKHKMAQKREDA--QKVM*KLSKANNRKMSQREKDER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 29 .68 RPM |
| SRP017611_kidney | 0 .00 RPM | 37 .90 RPM |
| SRP017611_liver | 0 .00 RPM | 43 .18 RPM |
| SRP040447_lung | 0 .00 RPM | 58 .56 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 57 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003125 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000008870 | 5 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000001517 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004643 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000005898 | 2 retrocopies |
retro_cpor_1243, retro_cpor_826 ,
|
| Dasypus novemcinctus | ENSDNOG00000000752 | 2 retrocopies | |
| Homo sapiens | ENSG00000114850 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024038 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015478 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000016970 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010589 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014233 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015560 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010578 | 1 retrocopy |