RetrogeneDB ID: | retro_cpor_659 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_21:25877488..25877741(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | OSTC | ||
| Ensembl ID: | ENSCPOG00000024467 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.3 % |
| Parental protein coverage: | 57.05 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | AMTVYALV-VVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGG |
| AM.V..LV..VS.FLI.G.II.DVI...PSV.S.T.EH...R..AFL....NG...ME..AS.FLFT.GG | |
| Retrocopy | AMMVDTLV>AVSHFLIAG-II*DVITGQPSVSSVTAEHRCWRRAAFLVF*ANGRCLMERQASGFLFTRGG |
| Parental | LGFIILDRSNAPNIPK |
| .GF..LD.SNAPNIPK | |
| Retrocopy | VGFTMLDQSNAPNIPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 8 .97 RPM |
| SRP017611_kidney | 1 .36 RPM | 32 .87 RPM |
| SRP017611_liver | 0 .00 RPM | 33 .25 RPM |
| SRP040447_lung | 0 .93 RPM | 31 .05 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 15 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001753 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000011286 | 12 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016002 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000024467 | 1 retrocopy |
retro_cpor_659 ,
|
| Echinops telfairi | ENSETEG00000003717 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026873 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000020599 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008869 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000041084 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011056 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005915 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023322 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009145 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021644 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000724 | 2 retrocopies |