RetrogeneDB ID: | retro_cpor_184 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_1:67758774..67759201(+) | ||
| Located in intron of: | ENSCPOG00000015508 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000005330 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.75 % |
| Parental protein coverage: | 69.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | ACMVTIILLLSCDFWTVKNVTGRLMVGLRWWNHIDEDGK-SHWVFESRKATSQESKSF-SEAESRIFWLG |
| AC.VTII.LLSCD.W.V.N.TGRLM.GL.WW.H..ED.K.S.WVFE.RKA.SQE.K.F.S.AESRIFWL. | |
| Retrocopy | ACTVTIIFLLSCDSWAVNNATGRLMAGLCWWSHTYEDRK>SQWVFEPRKASSQENKVF<SQAESRIFWLS |
| Parental | LIACPVLWVIFAFSALFSFR-LKWLAVVIMGVVLQGANLYGYVKCKVGSRKNLTSMATSYLGKQFLRQNT |
| .IACP.LW..FA...L.S.R..KWL.VVI.G..L.GA.LYG...C.VGSR..LTSM.T.Y.G.QFLRQNT | |
| Retrocopy | VIACPGLWARFALEVLLSLR>VKWLVVVITGLTLHGATLYGCTSCEVGSR-TLTSMVTAYPGTQFLRQNT |
| Parental | GDDQTS |
| G..QTS | |
| Retrocopy | GEAQTS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .75 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .85 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .45 RPM |
| SRP040447_lung | 0 .00 RPM | 12 .51 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 3 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000005330 | 1 retrocopy |
retro_cpor_184 ,
|
| Dasypus novemcinctus | ENSDNOG00000007609 | 2 retrocopies | |
| Homo sapiens | ENSG00000171928 | 1 retrocopy | |
| Homo sapiens | ENSG00000175106 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003854 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002825 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019203 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014658 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000000498 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012225 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007790 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008796 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050649 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000642 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008082 | 2 retrocopies |