RetrogeneDB ID: | retro_cpor_1062 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_42:7729240..7729597(+) | ||
| Located in intron of: | ENSCPOG00000007134 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL18 | ||
| Ensembl ID: | ENSCPOG00000026334 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L18 [Source:UniProtKB/TrEMBL;Acc:H0W177] |
| Percent Identity: | 61.34 % |
| Parental protein coverage: | 63.3 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 0 |
| Parental | GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMK |
| GV...H.K..KV..KEP.SQDIYLRLLVKL.RFLA..TN.TFNQVVLK.LFM...N.P..SLS.MI.KMK | |
| Retrocopy | GVNVCHKKAQKV*CKEPRSQDIYLRLLVKLFRFLAK*TNFTFNQVVLKGLFMFCSNLPTKSLS*MI*KMK |
| Parental | LPGRENKTAVVVGTVTDDVRVLEVPKLKVCALRVTSRARSRILKAGGKI |
| .PG.ENKTAVV..T..D.....EV..LKVC.L...S.A.S.I.KA..K. | |
| Retrocopy | FPGWENKTAVVMRTILDNMQAQEVVELKVCSLCLSSQASSHIFKARDKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .17 RPM | 83 .57 RPM |
| SRP017611_kidney | 0 .00 RPM | 155 .88 RPM |
| SRP017611_liver | 0 .09 RPM | 85 .88 RPM |
| SRP040447_lung | 0 .15 RPM | 269 .03 RPM |
| SRP040447_skeletal_muscle | 0 .01 RPM | 210 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014872 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000026334 | 4 retrocopies | |
| Felis catus | ENSFCAG00000008652 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024878 | 7 retrocopies | |
| Macropus eugenii | ENSMEUG00000000640 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022158 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000014099 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003891 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000059070 | 11 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004537 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003562 | 16 retrocopies | |
| Oreochromis niloticus | ENSONIG00000006539 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010206 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000021035 | 14 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006564 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000025928 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000012258 | 5 retrocopies |