RetrogeneDB ID: | retro_cjac_979 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 12:49293096..49293419(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FAM32A | ||
| Ensembl ID: | ENSCJAG00000014097 | ||
| Aliases: | None | ||
| Description: | protein FAM32A [Source:RefSeq peptide;Acc:NP_001240714] |
| Percent Identity: | 65.45 % |
| Parental protein coverage: | 96.43 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | YEQVQKGPLKLKGVAELGVTKR-KKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKR |
| Y.QVQKG.LK.KG..ELGVT.....K...K...K..EAMGTSKK..EEK...L.K.T.AQAAF.KMQEK. | |
| Retrocopy | YKQVQKGLLKPKGITELGVTQQ>RRKRSTKTRPK*-EAMGTSKKSAEEKWCDLGKLTLAQAAFKKMQEKS |
| Parental | QMERILKK-ASKTHKQRVEDFNRHLDTLTEHYDIPKVSWT |
| Q.ERILKK.AS.THKQR.EDF.RHLDT..EH.D.PKV.WT | |
| Retrocopy | QRERILKK>ASQTHKQREEDFSRHLDTRREHHDTPKVNWT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 7 .65 RPM |
| SRP051959_heart | 0 .00 RPM | 5 .28 RPM |
| SRP051959_kidney | 0 .00 RPM | 7 .88 RPM |
| SRP051959_liver | 0 .00 RPM | 6 .35 RPM |
| SRP051959_lung | 0 .00 RPM | 8 .82 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 6 .55 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 3 .04 RPM |
| SRP051959_spleen | 0 .02 RPM | 7 .67 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_693 |
| Pan troglodytes | retro_ptro_497 |
| Gorilla gorilla | retro_ggor_592 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
| Homo sapiens | ENSG00000105058 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002238 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |