RetrogeneDB ID: | retro_cjac_2976 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 7:56044327..56044613(-) | ||
| Located in intron of: | ENSCJAG00000005912 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MPHOSPH6 | ||
| Ensembl ID: | ENSCJAG00000016498 | ||
| Aliases: | None | ||
| Description: | M-phase phosphoprotein 6 [Source:HGNC Symbol;Acc:7214] |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 60. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | MAAERKS-KLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEK-ESFIIEEQSFLLCE |
| MA.E.K...LSKNLL.MK.MQR..DSETKK.LEE...K.IS.EHWY..LPEL......FIIEEQS.LLC. | |
| Retrocopy | MAPEHKT<QLSKNLLHMKLMQREPDSETKK*LEEKYNK-IS*EHWYSYLPELNKR>KNFIIEEQSLLLC* |
| Parental | DLLYGR-MSFRGFNPEVEKLMLHMNAKHK |
| ..LYGR.MSF..F.PEVEKLML....K.K | |
| Retrocopy | GHLYGR>MSFIRFTPEVEKLMLILRTKQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 1 .89 RPM | 4 .13 RPM |
| SRP051959_heart | 1 .33 RPM | 3 .79 RPM |
| SRP051959_kidney | 1 .49 RPM | 3 .51 RPM |
| SRP051959_liver | 0 .87 RPM | 1 .04 RPM |
| SRP051959_lung | 1 .87 RPM | 2 .54 RPM |
| SRP051959_lymph_node | 3 .29 RPM | 3 .06 RPM |
| SRP051959_skeletal_muscle | 0 .90 RPM | 3 .63 RPM |
| SRP051959_spleen | 2 .27 RPM | 2 .73 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_367 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000127 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016498 | 5 retrocopies | |
| Dipodomys ordii | ENSDORG00000011060 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000010276 | 6 retrocopies | |
| Homo sapiens | ENSG00000135698 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001405 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000580 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000268 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022575 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031843 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010725 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000024341 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012532 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000007592 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008398 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050087 | 6 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013110 | 8 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001928 | 2 retrocopies |