RetrogeneDB ID: | retro_cjac_2028 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 21:29646588..29646915(+) | ||
| Located in intron of: | ENSCJAG00000013778 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FDX1 | ||
| Ensembl ID: | ENSCJAG00000010395 | ||
| Aliases: | None | ||
| Description: | ferredoxin 1 [Source:HGNC Symbol;Acc:3638] |
| Percent Identity: | 73.64 % |
| Parental protein coverage: | 63.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | DGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIFEKLDAITDEENDMLDLAYGL |
| ..ETLT.KGKV.D.LLDVVVENNLDI..F.A.EGTLACS.CHL.FE.HIFEKLD.ITD.E.DMLDLAYGL | |
| Retrocopy | NSETLTNKGKVDDALLDVVVENNLDINRFVAGEGTLACSVCHLVFEKHIFEKLDTITDKEIDMLDLAYGL |
| Parental | TDRSRLGCQICLTKSMDNMTVRVPETVADARQSVDVGKTS |
| TDRS.L.CQICLTKSMD.MT......VA.AR.S.D.GKT. | |
| Retrocopy | TDRSELHCQICLTKSMDHMTMST-*GVASARPSIDMGKTT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .09 RPM | 6 .48 RPM |
| SRP051959_heart | 0 .25 RPM | 6 .30 RPM |
| SRP051959_kidney | 0 .04 RPM | 9 .72 RPM |
| SRP051959_liver | 0 .06 RPM | 30 .71 RPM |
| SRP051959_lung | 0 .42 RPM | 5 .99 RPM |
| SRP051959_lymph_node | 0 .05 RPM | 3 .47 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 4 .26 RPM |
| SRP051959_spleen | 0 .06 RPM | 4 .83 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2501 |
| Gorilla gorilla | retro_ggor_1560 |
| Pan troglodytes | retro_ptro_1452 |
| Pongo abelii | retro_pabe_1841 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010395 | 1 retrocopy |
retro_cjac_2028 ,
|
| Callithrix jacchus | ENSCJAG00000037004 | 1 retrocopy | |
| Homo sapiens | ENSG00000137714 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022443 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007249 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017826 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003853 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000004260 | 2 retrocopies |