RetrogeneDB ID: | retro_cjac_1753 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 19:40056264..40056509(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000037004 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.88 % |
| Parental protein coverage: | 56.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | RQAGE-EA-GGPERPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVS |
| RQAGE.EA...PERPG.VV.VVFVD.SG.RIPVS.RV.D.V.HL...HGV..E..CEA.LACSTCHV.VS | |
| Retrocopy | RQAGEEEA<SDPERPGNVVSVVFVDPSGWRIPVSSRVRDSVVHLTPCHGVNVESTCEAFLACSTCHVHVS |
| Parental | EDHLDLLPPPEER |
| .D.LDLL.PPE.R | |
| Retrocopy | KDRLDLLSPPEKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 1 .26 RPM |
| SRP051959_heart | 0 .00 RPM | 2 .21 RPM |
| SRP051959_kidney | 0 .00 RPM | 2 .86 RPM |
| SRP051959_liver | 0 .00 RPM | 3 .12 RPM |
| SRP051959_lung | 0 .00 RPM | 2 .91 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 2 .40 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 1 .79 RPM |
| SRP051959_spleen | 0 .00 RPM | 2 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_331 |
| Pan troglodytes | retro_ptro_267 |
| Gorilla gorilla | retro_ggor_355 |
| Macaca mulatta | retro_mmul_584 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010395 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000037004 | 1 retrocopy |
retro_cjac_1753 ,
|
| Homo sapiens | ENSG00000267673 | 1 retrocopy |