RetrogeneDB ID: | retro_cjac_1594 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 17:40362191..40362609(-) | ||
| Located in intron of: | ENSCJAG00000002644 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TDGF1 | ||
| Ensembl ID: | ENSCJAG00000002174 | ||
| Aliases: | None | ||
| Description: | teratocarcinoma-derived growth factor 1 [Source:HGNC Symbol;Acc:11701] |
| Percent Identity: | 75.18 % |
| Parental protein coverage: | 73.66 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | PSQGDLAFRDDSIRPRE-PAIRSWSSKLVPPVGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEH |
| PSQG.LAF.DDSIRP.E.P.IR..SS.L..P.GIQ.SKE.NRTCCLNGGTC.LGSFCACP.SFY..NCEH | |
| Retrocopy | PSQGNLAFSDDSIRPQEEPGIRPQSSQLALPMGIQNSKEQNRTCCLNGGTCTLGSFCACP-SFYRQNCEH |
| Parental | DVRRKNCGSVPHDTWLPKKCSLCKCWHGQLRCFPQTFLPGCDGLVMDEHLMASRTPE--LPPSAC-TTLM |
| DV...NCGSVPH.TWLPKKCS..KCWH.Q.RCFPQ.FLPGCDG..MDEHLMA..TPE..LP.SAC.TT.M | |
| Retrocopy | DVSKENCGSVPHGTWLPKKCSMSKCWHDQFRCFPQAFLPGCDGPLMDEHLMATKTPELPLPLSAC>TTFM |
| Parental | L |
| L | |
| Retrocopy | L |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .55 RPM | 0 .00 RPM |
| SRP051959_heart | 0 .25 RPM | 0 .00 RPM |
| SRP051959_kidney | 0 .44 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .35 RPM | 4 .40 RPM |
| SRP051959_lung | 0 .52 RPM | 0 .02 RPM |
| SRP051959_lymph_node | 0 .78 RPM | 0 .02 RPM |
| SRP051959_skeletal_muscle | 0 .17 RPM | 0 .00 RPM |
| SRP051959_spleen | 0 .40 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002174 | 3 retrocopies |
retro_cjac_1594 , retro_cjac_4151, retro_cjac_938,
|
| Felis catus | ENSFCAG00000014508 | 1 retrocopy | |
| Homo sapiens | ENSG00000241186 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003453 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000009140 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000016492 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003088 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015167 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032494 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006143 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000017039 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014854 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000013609 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017299 | 1 retrocopy |