RetrogeneDB ID: | retro_cjac_1268 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 14:32492619..32492961(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TAF13 | ||
| Ensembl ID: | ENSCJAG00000002701 | ||
| Aliases: | None | ||
| Description: | TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa [Source:HGNC Symbol;Acc:11546] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 95.16 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 2 |
| Parental | EDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTH-KAMS |
| E....EEENE....G.EG..GKRKRLF.K.L.C.MYGFGD.QNPYTE.VDILE.L..EFI.EM.....M. | |
| Retrocopy | ENHISEEENE----GVEGRSGKRKRLFPK*L*CLMYGFGDYQNPYTEPVDILENLLTEFINEMMN<LPML |
| Parental | IGRQGRVQVEDIVFLIRKDPRKFARV-KDLLTMNEELKRARKAFDEANYG |
| IGR...VQVE..VFLI.KDPRKFARV.KDL.TMNE.LK.ARKAFD..N.G | |
| Retrocopy | IGRPDQVQVEETVFLI*KDPRKFARV>KDLVTMNE*LK*ARKAFDKVNCG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .33 RPM | 2 .75 RPM |
| SRP051959_heart | 0 .12 RPM | 3 .00 RPM |
| SRP051959_kidney | 0 .20 RPM | 2 .66 RPM |
| SRP051959_liver | 0 .02 RPM | 3 .73 RPM |
| SRP051959_lung | 0 .41 RPM | 3 .01 RPM |
| SRP051959_lymph_node | 0 .32 RPM | 1 .83 RPM |
| SRP051959_skeletal_muscle | 0 .07 RPM | 3 .89 RPM |
| SRP051959_spleen | 0 .15 RPM | 3 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004542 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019855 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003347 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002701 | 3 retrocopies |
retro_cjac_1241, retro_cjac_1268 , retro_cjac_969,
|
| Cavia porcellus | ENSCPOG00000001081 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018227 | 16 retrocopies | |
| Loxodonta africana | ENSLAFG00000011432 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000008725 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000048100 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002350 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013494 | 6 retrocopies | |
| Procavia capensis | ENSPCAG00000005773 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000008033 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006839 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011144 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003167 | 1 retrocopy |