RetrogeneDB ID: | retro_chof_1592 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_333018:546..783(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TBCA | ||
| Ensembl ID: | ENSCHOG00000002112 | ||
| Aliases: | None | ||
| Description: | tubulin folding cofactor A [Source:HGNC Symbol;Acc:11579] |
| Percent Identity: | 85. % |
| Parental protein coverage: | 60.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | EAKQQEEKVEKMRAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYTDLLQLLESEKDLEEAEEYKDAR |
| ..K...EKVEKMRAEDGENYAIKKQAEILQES.MMIPDCQRRLEAA.T.LLQLL.SEKDLEEAEEYK... | |
| Retrocopy | QRKSNVEKVEKMRAEDGENYAIKKQAEILQESQMMIPDCQRRLEAAHTELLQLLKSEKDLEEAEEYK-VH |
| Parental | SVLDSVKLEA |
| SVLDSVKLEA | |
| Retrocopy | SVLDSVKLEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000014223 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000002112 | 2 retrocopies |
retro_chof_1592 , retro_chof_304,
|
| Callithrix jacchus | ENSCJAG00000019848 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000005316 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011853 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011849 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000048342 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000001561 | 1 retrocopy |