RetrogeneDB ID: | retro_sscr_590 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 18:8053670..8054058(+) | ||
| Located in intron of: | ENSSSCG00000016487 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TPGS2 | ||
| Ensembl ID: | ENSSSCG00000026953 | ||
| Aliases: | None | ||
| Description: | tubulin polyglutamylase complex subunit 2 [Source:HGNC Symbol;Acc:24561] |
| Percent Identity: | 76.69 % |
| Parental protein coverage: | 52.8 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MISSWEQK-NNCLLPEDLKNFYLMTNGFHMTWSVKLDEHTIPLGSMAINSISKLTQLNQSSMYSLPNAPT |
| MISSWEQK..NCLL...L.NFYL.T.GFHMTW.VKL..HTIPL..MAINSISKLTQL.Q.SM.S.PNAPT | |
| Retrocopy | MISSWEQK>SNCLLRANLQNFYLITDGFHMTWRVKLVAHTIPLSCMAINSISKLTQLSQPSMHSTPNAPT |
| Parental | LADLEDDTQEGNWTGENQPEKPHFDSRSVIFELDPCNGNGKVCLVYKRGKPALAQDSEIWFLD |
| LADLEDDTQE.....ENQPEKP.F.S.SVIFELDPC.GNG...LVYKRGKPA.AQDSE.WFLD | |
| Retrocopy | LADLEDDTQEAS---ENQPEKPRFNSCSVIFELDPCKGNGEAFLVYKRGKPAVAQDSEVWFLD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 3 .98 RPM |
| SRP014902_testis | 0 .14 RPM | 18 .67 RPM |
| SRP018288_heart | 0 .00 RPM | 18 .91 RPM |
| SRP018288_kidney | 0 .10 RPM | 13 .20 RPM |
| SRP018288_liver | 0 .48 RPM | 3 .68 RPM |
| SRP018288_lung | 0 .00 RPM | 18 .02 RPM |
| SRP018856_adipose | 0 .08 RPM | 31 .17 RPM |
| SRP035408_brain | 0 .06 RPM | 55 .90 RPM |
| SRP035408_liver | 0 .03 RPM | 5 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017766 | 3 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007960 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005257 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001739 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001097 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000024269 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008218 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014957 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026953 | 1 retrocopy |
retro_sscr_590 ,
|
| Tarsius syrichta | ENSTSYG00000005299 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007153 | 1 retrocopy |