RetrogeneDB ID: | retro_sscr_1121 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | GL895893.2:57576..57762(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DUT | ||
| Ensembl ID: | ENSSSCG00000026096 | ||
| Aliases: | None | ||
| Description: | deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:3078] |
| Percent Identity: | 70.97 % |
| Parental protein coverage: | 83.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTKRGSGGFGST |
| V.DEDYRG.VG.V.FNFGKE...VKK.....QLICE.I.YPEIEEVQVLDDT.R.S..FGST | |
| Retrocopy | VLDEDYRGDVGIVVFNFGKEMSDVKKDV*MVQLICEQISYPEIEEVQVLDDTERDSRSFGST |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 1 .46 RPM |
| SRP014902_testis | 0 .00 RPM | 8 .49 RPM |
| SRP018288_heart | 0 .00 RPM | 10 .43 RPM |
| SRP018288_kidney | 0 .00 RPM | 23 .35 RPM |
| SRP018288_liver | 0 .00 RPM | 8 .32 RPM |
| SRP018288_lung | 0 .00 RPM | 7 .03 RPM |
| SRP018856_adipose | 0 .00 RPM | 5 .03 RPM |
| SRP035408_brain | 0 .00 RPM | 44 .34 RPM |
| SRP035408_liver | 0 .00 RPM | 53 .93 RPM |