RetrogeneDB ID: | retro_pvam_993 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_21328:1941..2170(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL27A | ||
| Ensembl ID: | ENSPVAG00000002887 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L27a [Source:HGNC Symbol;Acc:10329] |
| Percent Identity: | 70.89 % |
| Parental protein coverage: | 52.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MPSRLRKTRKLRGHV-SHGHGRIG-KHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNQS |
| M.SRLR.T.KL.GH..SHGHG.I..KH.KHPGG..NAGGMHHHRINF.KYHPGYFGKV.MRHYHLKRN.. | |
| Retrocopy | MLSRLRETQKLWGHG<SHGHGHIA<KHQKHPGGQSNAGGMHHHRINFNKYHPGYFGKVAMRHYHLKRNLP |
| Parental | FCPTVNLDK |
| .C......K | |
| Retrocopy | NCQPWSVNK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004205 | 15 retrocopies | |
| Bos taurus | ENSBTAG00000005349 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000006936 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011775 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000002296 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016616 | 7 retrocopies | |
| Mus musculus | ENSMUSG00000046364 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005442 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000002887 | 14 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014214 | 10 retrocopies |