RetrogeneDB ID: | retro_pvam_1461 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_9182:18014..18234(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBL5 | ||
| Ensembl ID: | ENSPVAG00000008628 | ||
| Aliases: | None | ||
| Description: | ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736] |
| Percent Identity: | 78.38 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTI-FKDHVSLGDYEIHDGMNLE |
| M.EVVCND.LGKKV..KCNTDDTI.DLKKLI.A.TG...NKI..K.WY.I.FKDHVSLGDYEIHD.MNLE | |
| Retrocopy | MTEVVCNDHLGKKVHMKCNTDDTIKDLKKLITA*TGIYCNKIIMKNWYII>FKDHVSLGDYEIHDWMNLE |
| Parental | LYYQ |
| LYYQ | |
| Retrocopy | LYYQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006097 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
| Homo sapiens | ENSG00000198258 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000007877 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009536 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010451 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000008628 | 1 retrocopy |
retro_pvam_1461 ,
|
| Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023331 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008535 | 1 retrocopy |