RetrogeneDB ID: retro_hsap_2798

Retrocopy location

• Organism: Human (Homo sapiens)
• Coordinates: 3:63188896..63189052(-)
• Located in intron of: None

Retrocopy information

• Ensembl ID: ENSG00000240359
• Aliases: None
• Status: KNOWN_PSEUDOGENE

Parental gene information

• Parental gene symbol: UBL5
• Ensembl ID: ENSG00000198258
• Aliases: UBL5, HUB1
• Description: ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736]

Sequence

>retro_hsap_2798
GAGACCTTAAGAGACCGTAAGAAGCTGATTGCAGCCCAAGCTGTCACCCATTGTAAAAAGATTATCCTGAAGAAATGGTA
CATGATTTTTAGGGACCACACGATACTGGGGGACCATGAAATCCATGATGGGATGGACCTGGAGCTTTATTTTCAA

Alignment

ORF - retro_hsap_2798 Open Reading Frame is conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 67.31 %
• Parental protein coverage: 71.23 %
• Number of stop codons detected: 0
• Number of frameshifts detected: 0

Retrocopy - Parental Gene Alignment:

Parental  DTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
          .T..D.KKLIAAQ..T...KI.LKKWY.IF.DH..LGD.EIHDGM.LELY.Q
Retrocopy ETLRDRKKLIAAQAVTHCKKIILKKWYMIFRDHTILGDHEIHDGMDLELYFQ

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Expression validation based on RNA-Seq data:

Library	Retrocopy expression	Parental gene expression
bodymap2_adipose	0.00 RPM	54.49 RPM
bodymap2_adrenal	0.00 RPM	75.20 RPM
bodymap2_brain	0.00 RPM	74.42 RPM
bodymap2_breast	0.00 RPM	74.94 RPM
bodymap2_colon	0.00 RPM	85.12 RPM
bodymap2_heart	0.00 RPM	72.66 RPM
bodymap2_kidney	0.00 RPM	83.38 RPM
bodymap2_liver	0.00 RPM	54.23 RPM
bodymap2_lung	0.00 RPM	78.53 RPM
bodymap2_lymph_node	0.00 RPM	69.46 RPM
bodymap2_ovary	0.00 RPM	80.69 RPM
bodymap2_prostate	0.00 RPM	86.20 RPM
bodymap2_skeletal_muscle	0.00 RPM	45.00 RPM
bodymap2_testis	0.00 RPM	125.79 RPM
bodymap2_thyroid	0.00 RPM	109.15 RPM
bodymap2_white_blood_cells	0.00 RPM	89.17 RPM

ChIP-Seq

RNA Polymerase II activity near the 5' end of retro_hsap_2798 was not detected

EST

No EST(s) were mapped for retro_hsap_2798 retrocopy.

TSS

No TSS is located nearby retro_hsap_2798 retrocopy 5' end.

Lab

retro_hsap_2798 was not experimentally validated.

Homology

Retrocopy orthology:

Retrocopy retro_hsap_2798 has 3 orthologous retrocopies within eutheria group .

Species	RetrogeneDB ID
Pan troglodytes	retro_ptro_1895
Pongo abelii	retro_pabe_2226
Macaca mulatta	retro_mmul_1437

---

Parental genes homology:

Parental genes homology involve 15 parental genes, and 30 retrocopies.

Species	Parental gene accession	Retrocopies number
Callithrix jacchus	ENSCJAG00000006097	1 retrocopy	retro_cjac_1394,
Dasypus novemcinctus	ENSDNOG00000006384	5 retrocopies	retro_dnov_1858, retro_dnov_196, retro_dnov_2470, retro_dnov_2590, retro_dnov_860,
Homo sapiens	ENSG00000198258	3 retrocopies	retro_hsap_1821, retro_hsap_2798 , retro_hsap_3154,
Gorilla gorilla	ENSGGOG00000005999	1 retrocopy	retro_ggor_173,
Loxodonta africana	ENSLAFG00000012892	2 retrocopies	retro_lafr_1245, retro_lafr_699,
Macropus eugenii	ENSMEUG00000015506	2 retrocopies	retro_meug_300, retro_meug_304,
Myotis lucifugus	ENSMLUG00000027369	2 retrocopies	retro_mluc_1516, retro_mluc_1766,
Macaca mulatta	ENSMMUG00000007877	2 retrocopies	retro_mmul_1437, retro_mmul_1996,
Mus musculus	ENSMUSG00000084786	1 retrocopy	retro_mmus_98,
Pongo abelii	ENSPPYG00000009536	3 retrocopies	retro_pabe_1489, retro_pabe_2226, retro_pabe_2814,
Pan troglodytes	ENSPTRG00000010451	3 retrocopies	retro_ptro_1170, retro_ptro_1895, retro_ptro_2280,
Pteropus vampyrus	ENSPVAG00000008628	1 retrocopy	retro_pvam_1461,
Sarcophilus harrisii	ENSSHAG00000010974	1 retrocopy	retro_shar_753,
Sus scrofa	ENSSSCG00000023331	2 retrocopies	retro_sscr_544, retro_sscr_608,
Tursiops truncatus	ENSTTRG00000008535	1 retrocopy	retro_ttru_166,