RetrogeneDB ID: | retro_ptro_524 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 10:119130484..119130715(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TXN | ||
| Ensembl ID: | ENSPTRG00000021245 | ||
| Aliases: | None | ||
| Description: | thioredoxin [Source:HGNC Symbol;Acc:12435] |
| Percent Identity: | 83.12 % |
| Parental protein coverage: | 73.33 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE |
| MVKQIESK.AFQE.L.AAGDK.V.VDFSATW.GPCK.IK.FFHSLSEKYSN..F.EV.V.DCQDVASECE | |
| Retrocopy | MVKQIESKVAFQEGLEAAGDKFVMVDFSATWYGPCKKIKLFFHSLSEKYSNMVFFEVHVADCQDVASECE |
| Parental | VKCMPTF |
| VKCMPTF | |
| Retrocopy | VKCMPTF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 53 .78 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 42 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 33 .31 RPM |
| SRP007412_kidney | 0 .00 RPM | 134 .84 RPM |
| SRP007412_liver | 0 .03 RPM | 144 .91 RPM |
| SRP007412_testis | 0 .74 RPM | 12 .12 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_736 |
| Gorilla gorilla | retro_ggor_620 |