RetrogeneDB ID: | retro_ptro_1229 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 17:38501942..38502307(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TSEN15 | ||
| Ensembl ID: | ENSPTRG00000023202 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.99 % |
| Parental protein coverage: | 71.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MELDIGDATQVYVAFLVYLDLMESKS-WHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASFSHNR |
| MELD..DAT.VY.AFLVYLDL.ESK..WHE.NCV.LPELQLICLVGTEIE.EGLQTVVPTPITAS.SHNR | |
| Retrocopy | MELDTEDATHVYIAFLVYLDLIESKT<WHELNCVRLPELQLICLVGTEIEEEGLQTVVPTPITASLSHNR |
| Parental | IREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR |
| IREILKAS.KL.GDPDL.MSFTLAI.ESDSTIVYY.LTDGFMLPDPQNISLRR | |
| Retrocopy | IREILKAS*KLPGDPDLLMSFTLAIMESDSTIVYYELTDGFMLPDPQNISLRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 13 .42 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .58 RPM |
| SRP007412_heart | 0 .00 RPM | 14 .54 RPM |
| SRP007412_kidney | 0 .03 RPM | 18 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .72 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1721 |
| Gorilla gorilla | retro_ggor_2267 |
| Pongo abelii | retro_pabe_1436 |
| Macaca mulatta | retro_mmul_1214 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016369 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005356 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017611 | 2 retrocopies | |
| Homo sapiens | ENSG00000198860 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015804 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000014109 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016409 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011790 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014980 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000018024 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003128 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000421 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000023202 | 2 retrocopies |
retro_ptro_1229 , retro_ptro_147,
|
| Pteropus vampyrus | ENSPVAG00000001103 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013230 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002941 | 2 retrocopies |