RetrogeneDB ID: | retro_ptro_1134 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 16:28784618..28784862(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSPTRG00000022575 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSPTRG00000018934 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001079924] |
| Percent Identity: | 97.56 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWN-KLGPNDQYKFYSVNV |
| MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDV.WDRNNPEPWN.KLGPNDQYKFYSVNV | |
| Retrocopy | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVYWDRNNPEPWN>KLGPNDQYKFYSVNV |
| Parental | DYSKLKKERPDF |
| DYSKLKKERPDF | |
| Retrocopy | DYSKLKKERPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 2 .34 RPM | 238 .82 RPM |
| SRP007412_cerebellum | 0 .18 RPM | 80 .80 RPM |
| SRP007412_heart | 1 .19 RPM | 209 .21 RPM |
| SRP007412_kidney | 0 .42 RPM | 128 .12 RPM |
| SRP007412_liver | 0 .13 RPM | 39 .74 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .48 RPM |