RetrogeneDB ID: | retro_psin_32 | ||
Retrocopy location | Organism: | Chinese softshell turtle (Pelodiscus sinensis) | |
| Coordinates: | JH206258.1:1550419..1550656(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPSIG00000004692 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.22 % |
| Parental protein coverage: | 78.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TTPSSARTSSDSLVGYVLVPFFLITVVGIVVAVMMYIQKKRRFDRLRHHLLPMYSYDPAEDLHEVEQELL |
| .TP...RTS.DSLVGY.LVPFFLITV.GIV..VMMY.QKKRRFDRLRHHLLP.YS.DP..DLHE.EQELL | |
| Retrocopy | STPTATRTSNDSLVGYILVPFFLITVIGIVLVVMMYFQKKRRFDRLRHHLLPVYSHDPTGDLHEAEQELL |
| Parental | GDPDDTKVM |
| .DPDDTK.. | |
| Retrocopy | EDPDDTKMI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001058 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000034519 | 1 retrocopy | |
| Equus caballus | ENSECAG00000005108 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011876 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062753 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013398 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004692 | 1 retrocopy |
retro_psin_32 ,
|