RetrogeneDB ID: | retro_mmus_1543 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 17:10898876..10899098(+) | ||
| Located in intron of: | ENSMUSG00000073465 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AI413582 | ||
| Ensembl ID: | ENSMUSG00000062753 | ||
| Aliases: | None | ||
| Description: | expressed sequence AI413582 [Source:MGI Symbol;Acc:MGI:2146839] |
| Percent Identity: | 85.14 % |
| Parental protein coverage: | 72.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSYDPAEELQEAE |
| M.N..VPN.PQANSD.MVGYVLGPFFLITLVG.VVA.VMYVQKKK.VD.L.HHLLPMYSYDPAEELQEAE | |
| Retrocopy | MNNMSVPNTPQANSDFMVGYVLGPFFLITLVGLVVAMVMYVQKKKQVDQLGHHLLPMYSYDPAEELQEAE |
| Parental | QELL |
| QEL. | |
| Retrocopy | QELM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 13 .55 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 15 .37 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .95 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .87 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .39 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .44 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001058 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000034519 | 1 retrocopy | |
| Equus caballus | ENSECAG00000005108 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011876 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062753 | 1 retrocopy |
retro_mmus_1543 ,
|
| Oryctolagus cuniculus | ENSOCUG00000013398 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004692 | 1 retrocopy |