RetrogeneDB ID: | retro_pabe_768 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 11:69226070..69226298(-) | ||
| Located in intron of: | ENSPPYG00000003664 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC58 | ||
| Ensembl ID: | ENSPPYG00000013486 | ||
| Aliases: | None | ||
| Description: | coiled-coil domain containing 58 [Source:HGNC Symbol;Acc:31136] |
| Percent Identity: | 78.95 % |
| Parental protein coverage: | 52.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAAPTGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRV |
| M.AP.GGVN.EEFA.FQELLKV.RT.DDRIV..LNT.VPTASF.GKIDASQTCKQ.Y.SLMA..ASR.RV | |
| Retrocopy | MVAPSGGVNWEEFAQFQELLKVIRTSDDRIVYKLNTKVPTASFVGKIDASQTCKQIYGSLMAVLASRNRV |
| Parental | IKNCIA |
| IKNC.A | |
| Retrocopy | IKNCTA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .88 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 2 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 9 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .07 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_722 |