RetrogeneDB ID: | retro_pabe_2350 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:138408792..138409153(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFS6 | ||
| Ensembl ID: | ENSPPYG00000015323 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7713] |
| Percent Identity: | 64.52 % |
| Parental protein coverage: | 99.19 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAAAMTFYRLLNRWGEAARSLHLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAID |
| MAAAM..Y.LL......A..L..GARCFGV...PTGEKV.H..QV.D.KD.R.I.FVG.QKEVN.NFA.D | |
| Retrocopy | MAAAM-IYQLLGWSSIVALNLPSGARCFGV*ALPTGEKVLHASQV-DNKDSRKIQFVGCQKEVNINFATD |
| Parental | LIAEQPVSEVETRVIACD-GGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHH |
| LI.EQP.SEVE..VI.C..G.G.ALG.PKV..N.DKETKTG.CGYCGL.F..HH | |
| Retrocopy | LITEQPMSEVESWVILCN>GWG-ALGYPKVCVNIDKETKTGICGYCGL*FKKHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .47 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 59 .57 RPM |
| SRP007412_kidney | 0 .00 RPM | 51 .34 RPM |
| SRP007412_liver | 0 .00 RPM | 23 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2838 |
| Pan troglodytes | retro_ptro_1924 |
| Macaca mulatta | retro_mmul_1473 |
| Callithrix jacchus | retro_cjac_1552 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
| Homo sapiens | ENSG00000145494 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000015323 | 1 retrocopy |
retro_pabe_2350 ,
|
| Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |