RetrogeneDB ID: | retro_pabe_1999 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2a:66371879..66372326(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KRTCAP2 | ||
| Ensembl ID: | ENSPPYG00000000756 | ||
| Aliases: | None | ||
| Description: | keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942] |
| Percent Identity: | 86.0 % |
| Parental protein coverage: | 92.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | FWARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFN |
| F.ARGA..TH..GMMVVGT.TSLA.SSLLSLLLF..MQM...QLASTEWLTI.GGL.GSGLFV.SLTAF. | |
| Retrocopy | FLARGANLTHRQGMMVVGTDTSLAISSLLSLLLFTAMQM*IHQLASTEWLTIRGGLHGSGLFVLSLTAFK |
| Parental | NLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPA |
| .LENLVFGKG.QAK.FPEILLCLLLALFASGLIHRVCVTTCFIFSMVGL.YINKI.STLYQAAAPVLTPA | |
| Retrocopy | ILENLVFGKGSQAKTFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLCYINKI-STLYQAAAPVLTPA |
| Parental | KVTGKSKKRN |
| KVTGKSKKRN | |
| Retrocopy | KVTGKSKKRN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 15 .37 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .36 RPM |
| SRP007412_heart | 0 .00 RPM | 15 .80 RPM |
| SRP007412_kidney | 0 .00 RPM | 29 .30 RPM |
| SRP007412_liver | 0 .03 RPM | 40 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2100 |
| Pan troglodytes | retro_ptro_1541 |
| Gorilla gorilla | retro_ggor_1635 |
| Macaca mulatta | retro_mmul_987 |
| Callithrix jacchus | retro_cjac_1289 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017055 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025085 | 3 retrocopies | |
| Homo sapiens | ENSG00000163463 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000756 | 1 retrocopy |
retro_pabe_1999 ,
|
| Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |