RetrogeneDB ID: | retro_fcat_477 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:68437659..68438054(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KRTCAP2 | ||
| Ensembl ID: | ENSFCAG00000025085 | ||
| Aliases: | None | ||
| Description: | keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942] |
| Percent Identity: | 82.71 % |
| Parental protein coverage: | 96.32 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SASMMLSSLL-SLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKG-FQAKIFP |
| .AS..LSSLL.SLLLF..MQMYS.QLASTE.LTIQG.LLGSGLF.FSLTAF.NLENLVFGK..FQAKIFP | |
| Retrocopy | TASLTLSSLLPSLLLFMEMQMYSPQLASTE*LTIQGTLLGSGLFIFSLTAFSNLENLVFGKD<FQAKIFP |
| Parental | EILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLAPAKVTGKGKKRN |
| EILLCLLLAL.AS.LIHRVCVTTCFIFS.VGL.Y.NKISST.YQATAP.L..AKVT.KGKKRN | |
| Retrocopy | EILLCLLLALSASSLIHRVCVTTCFIFSRVGLCYVNKISSTVYQATAPGLTLAKVTRKGKKRN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 14 .12 RPM |
| SRP017611_kidney | 0 .00 RPM | 30 .09 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017055 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025085 | 3 retrocopies |
retro_fcat_1496, retro_fcat_477 , retro_fcat_576,
|
| Homo sapiens | ENSG00000163463 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000756 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |