RetrogeneDB ID: | retro_ogar_2877 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873675.1:1527738..1528113(+) | ||
| Located in intron of: | ENSOGAG00000009962 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOGAG00000004468 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 89.6 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA |
| ..MQ.AKRANIRLP..VNRILYIRNLPYKITAEEMYDIFGKYGPI.QIRV.NTPETR.TAYVVYEDIFDA | |
| Retrocopy | VTMQEAKRANIRLPSKVNRILYIRNLPYKITAEEMYDIFGKYGPIHQIRVENTPETRETAYVVYEDIFDA |
| Parental | KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK |
| .NAC.HLSGFNVCNRYLVVLYYN.NRAFQKMDTKK.EEQLKLLKEKY.INTDPPK | |
| Retrocopy | TNACHHLSGFNVCNRYLVVLYYNGNRAFQKMDTKKEEEQLKLLKEKYSINTDPPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002786 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000003407 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000689 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007716 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007148 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015618 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031365 | 1 retrocopy | |
| Homo sapiens | ENSG00000115128 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001282 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013957 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000815 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004468 | 1 retrocopy |
retro_ogar_2877 ,
|
| Pongo abelii | ENSPPYG00000012603 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000011709 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000011902 | 1 retrocopy |