RetrogeneDB ID: | retro_cjac_2632 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:86496958..86497330(-) | ||
| Located in intron of: | ENSCJAG00000001185 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000007716 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.68 % |
| Parental protein coverage: | 99.2 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | AMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAK |
| AMQ.AKRA.I.LPPEVNRIL.IRNL.YKIT.E.MYDIFGKYG.I.QIRVGNTPETRGTAYVVYE.IF.AK | |
| Retrocopy | AMQVAKRAGI*LPPEVNRIL*IRNLSYKITTESMYDIFGKYGTIHQIRVGNTPETRGTAYVVYEEIFVAK |
| Parental | NACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK |
| NACDHL.G.NV.NR..VVLYYNAN.AFQKMDTK..EEQLKLLKEKYGINTDPPK | |
| Retrocopy | NACDHLLGVNVSNR*FVVLYYNANKAFQKMDTKEEEEQLKLLKEKYGINTDPPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .58 RPM | 10 .27 RPM |
| SRP051959_heart | 0 .37 RPM | 10 .38 RPM |
| SRP051959_kidney | 0 .47 RPM | 13 .51 RPM |
| SRP051959_liver | 0 .22 RPM | 21 .77 RPM |
| SRP051959_lung | 0 .50 RPM | 11 .81 RPM |
| SRP051959_lymph_node | 0 .73 RPM | 11 .23 RPM |
| SRP051959_skeletal_muscle | 0 .37 RPM | 11 .97 RPM |
| SRP051959_spleen | 1 .05 RPM | 12 .94 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002786 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000003407 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000689 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007716 | 2 retrocopies |
retro_cjac_2632 , retro_cjac_487,
|
| Dasypus novemcinctus | ENSDNOG00000007148 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015618 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031365 | 1 retrocopy | |
| Homo sapiens | ENSG00000115128 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001282 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013957 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000815 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004468 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012603 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000011709 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000011902 | 1 retrocopy |