RetrogeneDB ID: | retro_ogar_1292 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873541.1:15783482..15783692(-) | ||
| Located in intron of: | ENSOGAG00000000754 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5I | ||
| Ensembl ID: | ENSOGAG00000012271 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E [Source:HGNC Symbol;Acc:846] |
| Percent Identity: | 69.01 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MVPPVQVSPLIKLGRYSALFLGMAYGATRYSYLKPRAEEERRIAAEEKKKQDELKRIARELAE--DDSIL |
| MV..VQV..LIKLG.Y.ALFL...Y.A..YSYL.P.AE.E.R.AAEEKKKQDELK..ARELAE..DDSI. | |
| Retrocopy | MVGQVQVPLLIKLGHYTALFLSVVYRAACYSYLEPQAEAE-RTAAEEKKKQDELKWTARELAEAQDDSI* |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy |
retro_ogar_1292 ,
|
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |