RetrogeneDB ID: | retro_ocun_1609 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018716:3772301..3772515(+) | ||
| Located in intron of: | ENSOCUG00000023493 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS20 | ||
| Ensembl ID: | ENSOCUG00000003068 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S20 (RPS20), mRNA [Source:RefSeq mRNA;Acc:NM_001253734] |
| Percent Identity: | 88.89 % |
| Parental protein coverage: | 59.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKT-PCGEGSKT |
| KTPVEP.VAIHRIR.TLTS.N.KSLEK.CADLIRGAKEKNLKVKGPV.MPTKTL.ITTRKT.PCGEGSKT | |
| Retrocopy | KTPVEPDVAIHRIRVTLTSHNEKSLEKACADLIRGAKEKNLKVKGPVWMPTKTL*ITTRKT>PCGEGSKT |
| Parental | WD |
| WD | |
| Retrocopy | WD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 90 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 175 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 83 .40 RPM |