RetrogeneDB ID: | retro_ocun_1350 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 7:19753257..19753671(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF3J | ||
| Ensembl ID: | ENSOCUG00000005376 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 3, subunit J [Source:HGNC Symbol;Acc:3270] |
| Percent Identity: | 52.35 % |
| Parental protein coverage: | 55.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | QLADKLRLKKLQEESDLELAK-ETFGVNNTVYGIDAMNPSSREDFTEFGKLLKDKITQYEKSLYYASFLE |
| QLAD.L.L.K.Q.ESDLELAK.E.FG.NN.V.GIDAMN.SSR.DF...........T..........F.. | |
| Retrocopy | QLADNLWLRKAQGESDLELAK>EIFGINNIVSGIDAMNLSSRGDFRIWEITER*NYTICKVTIFCQYFAD |
| Parental | AL-VRDVCISLEIDDLKKITNSLTVLCSE-KQKQEKQSKAKKKKKGVVPGGGLKATMKDDL-ADYGGYDG |
| .L.V.DVC.SLE......IT...T.L.SE.K.KQ.KQS.....K..V.PGGGLKA.MKD.L..DY.G.DG | |
| Retrocopy | IL>VQDVCVSLE---MSEITDLFTALYSE<KWKQAKQS----QKESVAPGGGLKADMKDNL<VDYCGEDG |
| Parental | GYAQDYEDF |
| GY....EDF | |
| Retrocopy | GYVHEQEDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 25 .66 RPM |
| SRP017611_kidney | 0 .00 RPM | 28 .48 RPM |
| SRP017611_liver | 0 .08 RPM | 16 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002412 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012396 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000548 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000010372 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017696 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000027236 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005568 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005376 | 1 retrocopy |
retro_ocun_1350 ,
|