RetrogeneDB ID: | retro_ggor_1687 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2a:63533346..63533690(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF3J | ||
| Ensembl ID: | ENSGGOG00000000548 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.5 % |
| Parental protein coverage: | 52.23 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 3 |
| Parental | IKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNP |
| IK.KERQQKKR..EIKK.LEE.E.PKVLTPE...ADKL.LKK.Q..SDLELAK.TFGVNNTVY.ID...P | |
| Retrocopy | IKDKERQQKKR**EIKKKLEEREKPKVLTPEK-IADKLQLKKSQKKSDLELAK*TFGVNNTVYEIDSYEP |
| Parental | -SSRDDFTEFGKLLKD-KITQYEKSLYYASFLE-VLVRDVCISLEIDDLK |
| .S.RD.F....K..KD.KITQYEK.LYY.SF.....V.D.CIS.EIDDL. | |
| Retrocopy | <SLRDNFRVW-KVTKD>KITQYEK*LYYTSFFK<ASVWDECISSEIDDLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 17 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .37 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 19 .22 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .05 RPM |
| SRP007412_testis | 0 .00 RPM | 41 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002412 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012396 | 3 retrocopies | |
| Equus caballus | ENSECAG00000008716 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005052 | 1 retrocopy | |
| Homo sapiens | ENSG00000104131 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000000548 | 2 retrocopies |
retro_ggor_1687 , retro_ggor_41,
|
| Macropus eugenii | ENSMEUG00000010372 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005006 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017696 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000027236 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005568 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005376 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004694 | 1 retrocopy |