RetrogeneDB ID: | retro_nleu_831 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397274.1:29935480..29935782(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNEP1R1 | ||
| Ensembl ID: | ENSNLEG00000000727 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 50.91 % |
| Parental protein coverage: | 74.65 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | YIHCLQPATGRWRMLLIVVSVCTATG-AWNWLI-DPETQKVSFFTSLWNHPFFTISCITLIGLFF-AGIH |
| .I.CL......W...L......TA...A.NWLI.DP.TQK..F..SL.NH.FFT..C....GLF..AGIH | |
| Retrocopy | HIFCLWSTVRHWTTILRTMFIRTAAR<AGNWLIIDPKTQK-RFHPSL*NHLFFTGCC----GLFL<AGIH |
| Parental | KRVVAPSIIAARCRTVLAEYNMSCDDTGK-LILKPRPHVQ |
| KRVVAP.I.AA....V.A.YN..C.D.GK..ILK.RP.V. | |
| Retrocopy | KRVVAPLI*AAWYQIVFADYNTPC-DVGK>IILKSRPYVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
| Homo sapiens | ENSG00000205423 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies |
retro_nleu_1341, retro_nleu_831 ,
|
| Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007335 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |