RetrogeneDB ID: | retro_eeur_211 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_209704:4331..4629(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNEP1R1 | ||
| Ensembl ID: | ENSEEUG00000005737 | ||
| Aliases: | None | ||
| Description: | CTD nuclear envelope phosphatase 1 regulatory subunit 1 [Source:HGNC Symbol;Acc:26759] |
| Percent Identity: | 75.73 % |
| Parental protein coverage: | 98.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MNSLEQAEDLKAFERRLTEYIH--CLQPATGRWR-MLLIVVSVCTATGAWNWLIDPETQKVSFLTSLWNH |
| MNSLEQAEDLKAF.RR.TEYI...C..P...R.R..L..V.SV.TAT.AW.WLIDPETQKVSFLTSL.NH | |
| Retrocopy | MNSLEQAEDLKAFNRRFTEYIFIVCNLPLGIRER<LLIVV-SVSTATEAWKWLIDPETQKVSFLTSL*NH |
| Parental | PFFTISCITLIGLFFAGIHKR-VVAPSMYPLLR |
| P.FTISCITLI.LFFA.IHKR..VAPSMYPLLR | |
| Retrocopy | PLFTISCITLIRLFFAVIHKR<IVAPSMYPLLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .16 RPM | 5 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 11 .81 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy |
retro_eeur_211 ,
|
| Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
| Homo sapiens | ENSG00000205423 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007335 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |