RetrogeneDB ID: | retro_mmus_625 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 10:24567818..24568134(-) | ||
| Located in intron of: | ENSMUSG00000087400 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081259 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Dctn5 | ||
| Ensembl ID: | ENSMUSG00000030868 | ||
| Aliases: | Dctn5, 4930427E12Rik, C78178 | ||
| Description: | dynactin 5 [Source:MGI Symbol;Acc:MGI:1891689] |
| Percent Identity: | 85.85 % |
| Parental protein coverage: | 57.69 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLANVRVGRHCVVKSRSVIR |
| MELGELL.N.SEYIET.SGNKVS.QS.LCGSQNIVLNGKTIIMNDCII.GDLANV.VGRHCVVKSRSV.R | |
| Retrocopy | MELGELLCNNSEYIETVSGNKVSLQSGLCGSQNIVLNGKTIIMNDCIIQGDLANVGVGRHCVVKSRSVVR |
| Parental | PPF-KKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIG |
| ..F.K.FSKGV.FFPLHIGD.VFIEEDCVV.AAQIG | |
| Retrocopy | LLF>KQFSKGVVFFPLHIGDRVFIEEDCVVKAAQIG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 62 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 49 .59 RPM |
| SRP007412_heart | 0 .00 RPM | 21 .57 RPM |
| SRP007412_kidney | 0 .02 RPM | 38 .98 RPM |
| SRP007412_liver | 0 .00 RPM | 19 .61 RPM |
| SRP007412_testis | 0 .00 RPM | 24 .56 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006410 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020623 | 1 retrocopy | |
| Homo sapiens | ENSG00000166847 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012834 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007806 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012148 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000030868 | 2 retrocopies |
retro_mmus_2733, retro_mmus_625 ,
|
| Nomascus leucogenys | ENSNLEG00000012015 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007194 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007891 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018048 | 2 retrocopies |