RetrogeneDB ID: | retro_mmus_509 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:162500718..162500955(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | 1110001A16Rik | ||
| Ensembl ID: | ENSMUSG00000062691 | ||
| Aliases: | None | ||
| Description: | RIKEN cDNA 1110001A16 gene [Source:MGI Symbol;Acc:MGI:1915804] |
| Percent Identity: | 61.25 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | MARIMEPLARKIFKGVLAAELVGVAGAYCLFKKMHSSQDFRQTMSKKFPFILEVYYKSIEQSGMYGVREK |
| M.....P.ARKIF.GVL.AELVG..GA..LFKKM..SQ.FRQ.MS.K.P.IL...YKSIEQ..MY.VR.. | |
| Retrocopy | MTQTLGPPARKIFGGVLVAELVGGFGA*FLFKKMNLSQHFRQ-MSEKIPLILQAHYKSIEQY*MYVVRG* |
| Parental | DEEKWLTSKN |
| D.EK.L.SK. | |
| Retrocopy | DQEKYLESKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 3 .15 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .17 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .85 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .47 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
| Homo sapiens | ENSG00000218739 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000062691 | 2 retrocopies |
retro_mmus_426, retro_mmus_509 ,
|
| Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |