RetrogeneDB ID: | retro_ggor_2869 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:84646674..84646906(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000218739 | ||
| Ensembl ID: | ENSGGOG00000025368 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.25 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MARTLEPLAKKIFKGVLVAELVGVFGAYFLFSKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGI-RE |
| M..T..PL....FKGVLVAEL.G..G.YF.F.KM.TSQDFRQTMSKK.PFILEVYYKS.E.S...GI... | |
| Retrocopy | MTHTMKPLGNS-FKGVLVAEL-GIWGSYFVFNKMNTSQDFRQTMSKKFPFILEVYYKSIEQSRVCGI>EG |
| Parental | LDQKTWLNSK |
| .DQ..WLNSK | |
| Retrocopy | KDQEKWLNSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .81 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .92 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .88 RPM |
| SRP007412_testis | 0 .00 RPM | 12 .54 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4294 |
| Pan troglodytes | retro_ptro_2911 |
| Pongo abelii | retro_pabe_3499 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
| Homo sapiens | ENSG00000218739 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies |
retro_ggor_1755, retro_ggor_2869 ,
|
| Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |