RetrogeneDB ID: | retro_chof_328 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_7401:9928..10166(-) | ||
| Located in intron of: | ENSCHOG00000002617 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCHOG00000013008 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 80.25 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MARTMEPLAKKIFKAILVAEVMGIFGAYFLFNKMNTSQDFRETMSKKF-PFILEVYYKSLEHSGMYEIRE |
| MA..M..LAK.IFK.ILVAEVMGIFGAYFLFNKMNTSQDFR.TMSKK..PFILE..YKSLEHSGM...R. | |
| Retrocopy | MANPMQLLAK-IFKGILVAEVMGIFGAYFLFNKMNTSQDFRRTMSKKT>PFILEI*YKSLEHSGMCRTRQ |
| Parental | QDQEKWMNSKN |
| Q.QEKWMNSKN | |
| Retrocopy | QNQEKWMNSKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies |
retro_chof_328 , retro_chof_49,
|
| Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
| Homo sapiens | ENSG00000218739 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |