RetrogeneDB ID: | retro_mmus_3706 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:144778067..144778451(-) | ||
| Located in intron of: | ENSMUSG00000071679 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Hn1 | ||
| Ensembl ID: | ENSMUSG00000020737 | ||
| Aliases: | None | ||
| Description: | hematological and neurological expressed sequence 1 [Source:MGI Symbol;Acc:MGI:1096361] |
| Percent Identity: | 62.6 % |
| Parental protein coverage: | 83.77 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFG-TPEENPPSWAKSAGSK |
| .TTTTTF...D.NS.N.S.VL..P...S...LGFD.P.EQ.V.K.KMASNIFG.T.EEN..S.AKS...K | |
| Retrocopy | ITTTTTFESLDLNSINISQVLS-PSFWSIVWLGFDGPTEQSVKKSKMASNIFG>TLEENSSS*AKSEDAK |
| Parental | SSGGREDSESPGTQRSNS-SEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPV |
| .SG.R.D.ESPGT.RSN..SE.SSGD.LDLKG..D...N.DTDF.ANL..ME.KPVPAAP. | |
| Retrocopy | GSGSRKDLESPGTLRSNP<SEGSSGDVLDLKGVDDIYHNMDTDF*ANLGEMEKKPVPAAPM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 32 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .20 RPM |
| SRP007412_heart | 0 .00 RPM | 30 .85 RPM |
| SRP007412_kidney | 0 .00 RPM | 26 .83 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .54 RPM |
| SRP007412_testis | 0 .00 RPM | 184 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014553 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013294 | 1 retrocopy | |
| Homo sapiens | ENSG00000189159 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013996 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013971 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020737 | 6 retrocopies |
retro_mmus_1096, retro_mmus_2442, retro_mmus_2574, retro_mmus_3706 , retro_mmus_864, retro_mmus_934,
|
| Nomascus leucogenys | ENSNLEG00000000610 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002950 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000010887 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000024246 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003661 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015171 | 1 retrocopy |