RetrogeneDB ID: | retro_cjac_2715 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 6:45049683..45049976(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HN1 | ||
| Ensembl ID: | ENSCJAG00000014553 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.26 % |
| Parental protein coverage: | 54.14 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | TTTTTFKGVDPNSRNSSRVLRPPGG-GSNFSLGFDEPTEQPVRK-NKMASNIFGTPEENQASWAKSAGAK |
| T.T.T.KGVD.NSRNSS.VL..P...GSNF.LGF.EP.EQPVRK.NKMASNIFGTPEEN..SWA.SAGAK | |
| Retrocopy | TATATIKGVDFNSRNSSWVL*LPSV<GSNFPLGFNEPSEQPVRK>NKMASNIFGTPEENPPSWATSAGAK |
| Parental | SSGGREDLESSGLQRRNSSEASSGD-FLDLK |
| S.GG.EDL.SSGLQ.RNSS...S.D.FLDLK | |
| Retrocopy | SRGGGEDLKSSGLQGRNSSATYSAD<FLDLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 9 .07 RPM |
| SRP051959_heart | 0 .00 RPM | 1 .21 RPM |
| SRP051959_kidney | 0 .00 RPM | 1 .82 RPM |
| SRP051959_liver | 0 .00 RPM | 2 .58 RPM |
| SRP051959_lung | 0 .00 RPM | 4 .49 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 9 .63 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 6 .73 RPM |
| SRP051959_spleen | 0 .00 RPM | 6 .45 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2343 |
| Pan troglodytes | retro_ptro_1715 |
| Gorilla gorilla | retro_ggor_1780 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014553 | 1 retrocopy |
retro_cjac_2715 ,
|
| Echinops telfairi | ENSETEG00000013294 | 1 retrocopy | |
| Homo sapiens | ENSG00000189159 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013996 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013971 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020737 | 6 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000610 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002950 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000010887 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000024246 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003661 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015171 | 1 retrocopy |