RetrogeneDB ID: | retro_mmus_3257 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 9:27611801..27612119(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Naa20 | ||
| Ensembl ID: | ENSMUSG00000002728 | ||
| Aliases: | Naa20, 1500004D14Rik, 2900026I01Rik, AU041458, D2Ertd186e, Nat5 | ||
| Description: | N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:MGI Symbol;Acc:MGI:1915127] |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 55.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | VTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEY-YSASN |
| ...LSV.P.F.R.GLAAK..ELLEEISER.GGFFVDLF.RVSNQV.V.MYKQLGYSVYRTVIEY.Y.... | |
| Retrocopy | ISKLSVYPDFHRPGLAAKIIELLEEISERNGGFFVDLFIRVSNQVTVSMYKQLGYSVYRTVIEY>YYSAS |
| Parental | -GEPDEDAYDMRKALSRDTEKKSIIPLPHP-VRPEDIE |
| .GEPDEDAY.MRKALSRDTEKKSIIPLP....RPEDIE | |
| Retrocopy | NGEPDEDAYEMRKALSRDTEKKSIIPLPYS<LRPEDIE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 24 .46 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 21 .58 RPM |
| SRP007412_heart | 0 .00 RPM | 24 .31 RPM |
| SRP007412_kidney | 0 .00 RPM | 17 .15 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .53 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001144 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000032025 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005377 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004247 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006044 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001228 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000002728 | 3 retrocopies |
retro_mmus_1228, retro_mmus_3146, retro_mmus_3257 ,
|
| Nomascus leucogenys | ENSNLEG00000009855 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015481 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011542 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010746 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013299 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014733 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000969 | 1 retrocopy |