RetrogeneDB ID: | retro_mmus_2581 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:78540548..78540860(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Pdap1 | ||
| Ensembl ID: | ENSMUSG00000029623 | ||
| Aliases: | Pdap1, HASPP28, PAP, PAP1 | ||
| Description: | PDGFA associated protein 1 [Source:MGI Symbol;Acc:MGI:2448536] |
| Percent Identity: | 50.93 % |
| Parental protein coverage: | 58.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | HKGRVRQYTSPEEIDAQLQAEKQKANEEDEQEEGGDGASGDPKKEKKSLDSDESEDEDDDY--QQKRKGV |
| HK..VRQY.SP.E.DA..Q.EKQKANE.D.QEEGG.G..G.PK.E.KSL.....ED.D..Y...QK.KGV | |
| Retrocopy | HKSHVRQYISPQETDAKVQSEKQKANENDKQEEGGNGDTGEPKME-KSLKTNVKEDGDGHYDSKQKQKGV |
| Parental | EGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEI |
| ..L.DI...N..AQTTK....L......E.......EI | |
| Retrocopy | KRLTDIKIHNWMAQTTKEAFMLE---QEEIEKQKEKEI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 54 .18 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 54 .19 RPM |
| SRP007412_heart | 0 .00 RPM | 42 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 51 .26 RPM |
| SRP007412_liver | 0 .00 RPM | 41 .24 RPM |
| SRP007412_testis | 0 .00 RPM | 86 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
| Homo sapiens | ENSG00000106244 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029623 | 1 retrocopy |
retro_mmus_2581 ,
|
| Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |