RetrogeneDB ID: | retro_mmus_2331 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:22275921..22276338(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083376 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Pcnp | ||
| Ensembl ID: | ENSMUSG00000071533 | ||
| Aliases: | Pcnp, 1110018D06Rik, AI647035 | ||
| Description: | PEST proteolytic signal containing nuclear protein [Source:MGI Symbol;Acc:MGI:1923552] |
| Percent Identity: | 64.03 % |
| Parental protein coverage: | 78.09 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | SSNGGESSSRSAEKRSAEDEAADLPTKPTKMSKFGFAIGSQTARKASAISIRLGASKPKETVPTLAPKTL |
| SSN.G.SSS..A.K.S....AADL.TK.TK.SK..FA.GSQ...K.S..SIRLG.S..KE....L.PKTL | |
| Retrocopy | SSNEGRSSSCRAKKTSVKEAAADLLTKSTKTSKCEFAVGSQMTKKVSTLSIRLG*SNHKEVILSLTPKTL |
| Parental | SVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQ |
| SVAAA..EDEDSEPE.MP.EAK...KNI..DTPTSA.PN.FNK.K..F.D.QK.WE.NIK.HLGNVH.Q | |
| Retrocopy | SVAAALQEDEDSEPEDMPAEAKIGLKNIEKDTPTSAAPNPFNKEKRSFPDIQK*WEQNIKLHLGNVHSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 37 .96 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 30 .39 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .58 RPM |
| SRP007412_kidney | 0 .00 RPM | 19 .69 RPM |
| SRP007412_liver | 0 .00 RPM | 14 .53 RPM |
| SRP007412_testis | 0 .00 RPM | 12 .40 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2138 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007972 | 11 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000508 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008873 | 5 retrocopies | |
| Homo sapiens | ENSG00000081154 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025423 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000005518 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000008072 | 10 retrocopies | |
| Macaca mulatta | ENSMMUG00000017782 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011696 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000071533 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003224 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011110 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000007007 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013591 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000015172 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000028411 | 1 retrocopy |