RetrogeneDB ID: | retro_mmus_2227 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:14628821..14629240(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Fam213a | ||
| Ensembl ID: | ENSMUSG00000021792 | ||
| Aliases: | Fam213a, 5730469M10Rik, AU040822, Pamm | ||
| Description: | family with sequence similarity 213, member A [Source:MGI Symbol;Acc:MGI:1917814] |
| Percent Identity: | 68.28 % |
| Parental protein coverage: | 62.88 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | PGCFLCRAEAADLMSLKPKLDELGVPLYAV-VKEQVKREVEDFQPYFKGEIFLDEKKKFYGPERRKMMFM |
| PGCFL..AEAADL..LK.K.DEL.VP..AV.VK.QV.REV.DFQPY.KGEI.....K..YG.ERRK.MF. | |
| Retrocopy | PGCFLY*AEAADLSFLKLKSDELCVPPCAV<VKVQVEREVKDFQPYAKGEIWR-KRKESYGSERRKLMFT |
| Parental | GLIRLGVWYNSFRAWNGGFSGNLEGEGFILGGVFVIGSGKQGILLEHREKEFGDRVNPLSVLEAVKKIKL |
| GLI.LGVWYNSF.AW.G..SG.LEGEGFIL...F.I.SG.QGILLEH...EFGDRVNPL....A.K.IK. | |
| Retrocopy | GLIHLGVWYNSFWAWIGDVSGHLEGEGFILS--FCIRSGNQGILLEHGKEEFGDRVNPL-CSGAGKNIKA |
| Parental | QTPAS |
| QTPAS | |
| Retrocopy | QTPAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 70 .51 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 100 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 15 .57 RPM |
| SRP007412_kidney | 0 .00 RPM | 100 .14 RPM |
| SRP007412_liver | 0 .00 RPM | 57 .87 RPM |
| SRP007412_testis | 0 .00 RPM | 51 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_1517 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies | |
| Homo sapiens | ENSG00000122378 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021792 | 1 retrocopy |
retro_mmus_2227 ,
|
| Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |