RetrogeneDB ID: | retro_mmul_881 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:75129293..75129729(-) | ||
| Located in intron of: | ENSMMUG00000021329 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.10197 | ||
| Ensembl ID: | ENSMMUG00000021773 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.75 % |
| Parental protein coverage: | 68.02 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | KNGAVIMAVRRPGCFLCREEAADLSSL-KSMLDQLGVPLYAVVKEHIRTEVEDFQPYFKGEIFLDEKKKF |
| KNG.VI.AV..P.CFL..E.AADLSSL....LD.LGVPLYAVV.E.IRT....FQ..FK.EI.LD..KKF | |
| Retrocopy | KNGVVIVAV--PDCFLWQEGAADLSSL<QPKLDDLGVPLYAVVNEQIRTDIKFFQTCFKREILLDDNKKF |
| Parental | YGPQRRKMMFMGFIRLGVWYNFFR-AWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNL |
| YG.QR.K........L..W...F..AWN.GF.GNLE..GFIL.GVFVVGSGKQGI...H..KE.GDKVN. | |
| Retrocopy | YGLQRQKRLCLW--DLALWECGFQ<AWN*GFPGNLETQGFILKGVFVVGSGKQGI-PAHG*KEHGDKVNS |
| Parental | LSVLEAAKMIKPQ |
| LSVLEAA..IKP. | |
| Retrocopy | LSVLEAARKIKPE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 52 .55 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 48 .87 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 29 .03 RPM |
| SRP007412_kidney | 0 .00 RPM | 41 .90 RPM |
| SRP007412_liver | 0 .00 RPM | 19 .16 RPM |
| SRP007412_testis | 0 .00 RPM | 24 .27 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1135 |
| Pan troglodytes | retro_ptro_774 |
| Gorilla gorilla | retro_ggor_886 |
| Pongo abelii | retro_pabe_944 |
| Callithrix jacchus | retro_cjac_3312 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies | |
| Homo sapiens | ENSG00000122378 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies |
retro_mmul_2351, retro_mmul_2409, retro_mmul_881 ,
|
| Mus musculus | ENSMUSG00000021792 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |