RetrogeneDB ID: | retro_mmus_1320 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 15:5580516..5580869(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Psma2 | ||
| Ensembl ID: | ENSMUSG00000015671 | ||
| Aliases: | Psma2, Lmpc3 | ||
| Description: | proteasome (prosome, macropain) subunit, alpha type 2 [Source:MGI Symbol;Acc:MGI:104885] |
| Percent Identity: | 56.91 % |
| Parental protein coverage: | 52.14 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | LVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYN |
| LVQR.A.......QSGG..PF.V....CGWNEG...LFQSDPSGA.F.WKATAMGKN..N.KT....... | |
| Retrocopy | LVQRGA--LGDANQSGGICPF*V-YFSCGWNEG*LCLFQSDPSGADFGWKATAMGKNDGNEKT-CPAKIK |
| Parental | EDLELEDAIHTAILTLK-ESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLA |
| ...ELE.A...AILTLK.ES.EGQM.ED..EVGICNE..FRR...T......A | |
| Retrocopy | WSWELENASPAAILTLK<ESLEGQMAEDSMEVGICNEGEFRRPPLTDFENVTA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 53 .83 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 49 .89 RPM |
| SRP007412_heart | 0 .03 RPM | 43 .74 RPM |
| SRP007412_kidney | 0 .02 RPM | 57 .56 RPM |
| SRP007412_liver | 0 .00 RPM | 44 .27 RPM |
| SRP007412_testis | 0 .09 RPM | 21 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009433 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000000990 | 3 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000000644 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000013134 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011910 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015835 | 2 retrocopies | |
| Homo sapiens | ENSG00000106588 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006538 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010086 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000018145 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015671 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003177 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012092 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016805 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017612 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000019120 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000049920 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000020769 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014299 | 2 retrocopies |