RetrogeneDB ID: | retro_mmur_576 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | GeneScaffold_4010:1270127..1270373(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TAF13 | ||
| Ensembl ID: | ENSMICG00000008725 | ||
| Aliases: | None | ||
| Description: | TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa [Source:HGNC Symbol;Acc:11546] |
| Percent Identity: | 81.71 % |
| Parental protein coverage: | 66.13 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MADEEEDPAFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTH |
| MADEEE.P.FE.ENEEIGGGAE..QGKRKR.FS.EL.CMMYGFGDDQNP..ESVDILE.L.IEFITEMTH | |
| Retrocopy | MADEEENPTFEQENEEIGGGAEDRQGKRKRHFSEELSCMMYGFGDDQNP*MESVDILENLDIEFITEMTH |
| Parental | KAMSIGRQGRVQ |
| .AM.IGRQ.RVQ | |
| Retrocopy | RAMAIGRQDRVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004542 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019855 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003347 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002701 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000001081 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018227 | 16 retrocopies | |
| Loxodonta africana | ENSLAFG00000011432 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000008725 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000048100 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002350 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013494 | 6 retrocopies | |
| Procavia capensis | ENSPCAG00000005773 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000008033 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006839 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011144 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003167 | 1 retrocopy |