RetrogeneDB ID: | retro_mmur_417 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | GeneScaffold_2914:1001543..1001759(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSMICG00000002180 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 68.06 % |
| Parental protein coverage: | 61.54 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQ |
| ..A.G..PGRLRGV.AVRPKV.MRLS.TK.H.SRA.GGS.C...VR.RIKRAFLIEEQK..VK.L..QA. | |
| Retrocopy | QTARGMSPGRLRGVHAVRPKVPMRLSETKEHASRA*GGSLCVERVRGRIKRAFLIEEQKVAVKALRTQAE |
| Parental | SQ |
| S. | |
| Retrocopy | SE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |