RetrogeneDB ID: | retro_itri_344 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393285.1:19788315..19788551(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSSTOG00000025964 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 53.01 % |
| Parental protein coverage: | 68.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | VYLYTKKVGKAP-KSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSR-AYGGSMCAKCVRD-RIKRAFLI |
| VYLY...VGKAP.....G.C.....G.....P..LMRLSK..KH.S..A.GG.MCAK...D..IK..FL. | |
| Retrocopy | VYLYINNVGKAP<QPSSGMCWADFEGILVI-PNMLMRLSKMRKHISG<ACGGPMCAKYTCD>VIKHVFLT |
| Parental | EEQKIVVKVLKAQ |
| .E.KI.VKVLKAQ | |
| Retrocopy | KEPKITVKVLKAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |